Lineage for d2pqac_ (2pqa C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2382816Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2382884Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2382885Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2382891Domain d2pqac_: 2pqa C: [149790]
    Other proteins in same PDB: d2pqab_, d2pqad_
    automated match to d1l1ob_

Details for d2pqac_

PDB Entry: 2pqa (more details), 2.5 Å

PDB Description: Crystal Structure of Full-length Human RPA 14/32 Heterodimer
PDB Compounds: (C:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2pqac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqac_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvls

SCOPe Domain Coordinates for d2pqac_:

Click to download the PDB-style file with coordinates for d2pqac_.
(The format of our PDB-style files is described here.)

Timeline for d2pqac_: