SCOPe 2.08: Domain d2ppac2: 2ppa C:167-339

Lineage for d2ppac2 (2ppa C:167-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries)
   Uniprot P38501

8. Domain d2ppac2: 2ppa C:167-339 [149752]
   Other proteins in same PDB: d2ppaa1, d2ppab1, d2ppac1
   automated match to d1snra2
   complexed with act, cu, cu1, n2o, trs
   has additional insertions and/or extensions that are not grouped together

Details for d2ppac2

PDB Entry: 2ppa, 1.69 Å

PDB Description: Anaerobically manipulated wild type oxidized AfNiR bound to nitrous oxide

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2ppac2:

Sequence; same for both SEQRES and ATOM records:

>d2ppac2 b.6.1.3 (C:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d2ppac2:

• d2ppac2 first appeared in SCOP 1.75
  
• d2ppac2 appears in SCOPe 2.07