Lineage for d2ppaa2 (2ppa A:167-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. 2771579Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries)
    Uniprot P38501
  8. 2771616Domain d2ppaa2: 2ppa A:167-339 [149748]
    Other proteins in same PDB: d2ppaa1, d2ppab1, d2ppac1
    automated match to d1snra2
    complexed with act, cu, cu1, n2o, trs

    has additional insertions and/or extensions that are not grouped together

Details for d2ppaa2

PDB Entry: 2ppa (more details), 1.69 Å

PDB Description: Anaerobically manipulated wild type oxidized AfNiR bound to nitrous oxide
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2ppaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppaa2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOPe Domain Coordinates for d2ppaa2:

Click to download the PDB-style file with coordinates for d2ppaa2.
(The format of our PDB-style files is described here.)

Timeline for d2ppaa2: