Lineage for d2pnra1 (2pnr A:13-176)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488345Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1488346Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 1488352Protein Pyruvate dehydrogenase kinase [69016] (2 species)
  7. 1488353Species Human (Homo sapiens) [TaxId:9606] [158429] (5 PDB entries)
    Uniprot Q15120 13-176
  8. 1488354Domain d2pnra1: 2pnr A:13-176 [149696]
    Other proteins in same PDB: d2pnra2, d2pnrb2, d2pnrc_, d2pnre2, d2pnrf2, d2pnrg_
    automatically matched to 1Y8N A:13-176
    complexed with red

Details for d2pnra1

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d2pnra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnra1 a.29.5.1 (A:13-176) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdt

SCOPe Domain Coordinates for d2pnra1:

Click to download the PDB-style file with coordinates for d2pnra1.
(The format of our PDB-style files is described here.)

Timeline for d2pnra1: