SCOPe 2.06: Domain d2pmsd2: 2pms D:168-288

Lineage for d2pmsd2 (2pms D:168-288)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.19: PspA lactotransferrin-binding region [161270] (1 family)
   3 helices, the middle one is longer than the two others

5. Family h.4.19.1: PspA lactotransferrin-binding region [161271] (1 protein)

6. Protein Pneumococcal surface protein A, PspA [161272] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [161273] (1 PDB entry)
   Uniprot Q8DRI0 198-319

8. Domain d2pmsd2: 2pms D:168-288 [149672]
   Other proteins in same PDB: d2pmsc2, d2pmsd3
   automated match to d2pmsc1
   complexed with co3, fe, nag, so4, zn

Details for d2pmsd2

PDB Entry: 2pms, 2.91 Å

PDB Description: crystal structure of the complex of human lactoferrin n-lobe and lactoferrin-binding domain of pneumococcal surface protein a

PDB Compounds: (D:) pneumococcal surface protein a (pspa)

SCOPe Domain Sequences for d2pmsd2:

Sequence, based on SEQRES records:

>d2pmsd2 h.4.19.1 (D:168-288) Pneumococcal surface protein A, PspA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
daeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkaklskle
elsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlkkavn
e

Sequence, based on observed residues (ATOM records):

>d2pmsd2 h.4.19.1 (D:168-288) Pneumococcal surface protein A, PspA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
daeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkideldae
iakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne

Timeline for d2pmsd2:

• d2pmsd2 first appeared in SCOP 1.75, called d2pmsd1
  
• d2pmsd2 was called d2pmsd_ in SCOPe 2.05
  
• d2pmsd2 appears in SCOPe 2.07
  
• d2pmsd2 appears in the current release, SCOPe 2.08