Lineage for d2pmsd2 (2pms D:168-288)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646997Superfamily h.4.19: PspA lactotransferrin-binding region [161270] (1 family) (S)
    3 helices, the middle one is longer than the two others
  5. 2646998Family h.4.19.1: PspA lactotransferrin-binding region [161271] (1 protein)
  6. 2646999Protein Pneumococcal surface protein A, PspA [161272] (1 species)
  7. 2647000Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [161273] (1 PDB entry)
    Uniprot Q8DRI0 198-319
  8. 2647002Domain d2pmsd2: 2pms D:168-288 [149672]
    Other proteins in same PDB: d2pmsc2, d2pmsd3
    automated match to d2pmsc1
    complexed with co3, fe, nag, so4, zn

Details for d2pmsd2

PDB Entry: 2pms (more details), 2.91 Å

PDB Description: crystal structure of the complex of human lactoferrin n-lobe and lactoferrin-binding domain of pneumococcal surface protein a
PDB Compounds: (D:) pneumococcal surface protein a (pspa)

SCOPe Domain Sequences for d2pmsd2:

Sequence, based on SEQRES records: (download)

>d2pmsd2 h.4.19.1 (D:168-288) Pneumococcal surface protein A, PspA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
daeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkaklskle
elsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlkkavn
e

Sequence, based on observed residues (ATOM records): (download)

>d2pmsd2 h.4.19.1 (D:168-288) Pneumococcal surface protein A, PspA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
daeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkideldae
iakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne

SCOPe Domain Coordinates for d2pmsd2:

Click to download the PDB-style file with coordinates for d2pmsd2.
(The format of our PDB-style files is described here.)

Timeline for d2pmsd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pmsd3