SCOPe 2.02: Domain d2pjhb2: 2pjh B:107-200

Lineage for d2pjhb2 (2pjh B:107-200)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64255] (5 PDB entries)

8. Domain d2pjhb2: 2pjh B:107-200 [149564]
   Other proteins in same PDB: d2pjhb1
   automatically matched to d1e32a3

Details for d2pjhb2

PDB Entry: 2pjh

PDB Description: strctural model of the p97 n domain- npl4 ubd complex

PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d2pjhb2:

Sequence; same for both SEQRES and ATOM records:

>d2pjhb2 d.31.1.1 (B:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

Timeline for d2pjhb2:

• d2pjhb2 first appeared in SCOP 1.75
  
• d2pjhb2 appears in SCOPe 2.01
  
• d2pjhb2 appears in SCOPe 2.03
  
• d2pjhb2 appears in the current release, SCOPe 2.08