Lineage for d2pjhb2 (2pjh B:107-200)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858077Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 858078Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family) (S)
  5. 858079Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 858094Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (1 species)
  7. 858095Species Mouse (Mus musculus) [TaxId:10090] [64255] (5 PDB entries)
  8. 858097Domain d2pjhb2: 2pjh B:107-200 [149564]
    Other proteins in same PDB: d2pjhb1
    automatically matched to d1e32a3

Details for d2pjhb2

PDB Entry: 2pjh (more details)

PDB Description: strctural model of the p97 n domain- npl4 ubd complex
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOP Domain Sequences for d2pjhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjhb2 d.31.1.1 (B:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOP Domain Coordinates for d2pjhb2:

Click to download the PDB-style file with coordinates for d2pjhb2.
(The format of our PDB-style files is described here.)

Timeline for d2pjhb2: