SCOPe 2.08: Domain d2pihb_: 2pih B:

Lineage for d2pihb_ (2pih B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.281: YheA-like [158621] (1 superfamily)
   5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces

4. Superfamily a.281.1: YheA/YmcA-like [158622] (2 families)

5. Family a.281.1.1: YmcA-like [158623] (1 protein)
   N-terminal and C-terminal parts correspond to PfamB PB012831 and PfamB PB007043, respectively
   automatically mapped to Pfam PF06133

6. Protein Uncharacterized protein YmcA [158624] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [158625] (1 PDB entry)
   Uniprot O31779 2-124

8. Domain d2pihb_: 2pih B: [149512]
   automated match to d2piha1

Details for d2pihb_

PDB Entry: 2pih, 2.1 Å

PDB Description: crystal structure of protein ymca from bacillus subtilis, northeast structural genomics target sr375

PDB Compounds: (B:) Protein ymcA

SCOPe Domain Sequences for d2pihb_:

Sequence; same for both SEQRES and ATOM records:

>d2pihb_ a.281.1.1 (B:) Uncharacterized protein YmcA {Bacillus subtilis [TaxId: 1423]}
tlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlkh
yekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiitst
ggd

Timeline for d2pihb_:

• d2pihb_ first appeared in SCOP 1.75, called d2pihb1
  
• d2pihb_ appears in SCOPe 2.07