Lineage for d2phpd_ (2php D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619702Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 1619703Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 1619794Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
    automatically mapped to Pfam PF10120
  6. 1619799Protein Uncharacterized protein MJ0236 [159771] (1 species)
  7. 1619800Species Methanocaldococcus jannaschii [TaxId:2190] [159772] (1 PDB entry)
    Uniprot Q57688 241-420
  8. 1619803Domain d2phpd_: 2php D: [149476]
    automated match to d2phpa1
    complexed with cl

Details for d2phpd_

PDB Entry: 2php (more details), 2.03 Å

PDB Description: crystal structure of the c-terminal domain of protein mj0236 (y236_metja)
PDB Compounds: (D:) Uncharacterized protein MJ0236

SCOPe Domain Sequences for d2phpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phpd_ c.74.1.2 (D:) Uncharacterized protein MJ0236 {Methanocaldococcus jannaschii [TaxId: 2190]}
sltyinkekviknlsyaiyllkkmnftlipevgsniaeslpfpkdfkdvaaltgriiknk
lggfyivgdiefgasehiakiilsaskfnpeiracmnikydgglikllkdkfavssfdrk
eeppnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviqkiy
ntle

SCOPe Domain Coordinates for d2phpd_:

Click to download the PDB-style file with coordinates for d2phpd_.
(The format of our PDB-style files is described here.)

Timeline for d2phpd_: