SCOPe 2.05: Domain d2phpd_: 2php D:

Lineage for d2phpd_ (2php D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
   automatically mapped to Pfam PF10120

6. Protein Uncharacterized protein MJ0236 [159771] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [159772] (1 PDB entry)
   Uniprot Q57688 241-420

8. Domain d2phpd_: 2php D: [149476]
   automated match to d2phpa1
   complexed with cl

Details for d2phpd_

PDB Entry: 2php, 2.03 Å

PDB Description: crystal structure of the c-terminal domain of protein mj0236 (y236_metja)

PDB Compounds: (D:) Uncharacterized protein MJ0236

SCOPe Domain Sequences for d2phpd_:

Sequence; same for both SEQRES and ATOM records:

>d2phpd_ c.74.1.2 (D:) Uncharacterized protein MJ0236 {Methanocaldococcus jannaschii [TaxId: 2190]}
sltyinkekviknlsyaiyllkkmnftlipevgsniaeslpfpkdfkdvaaltgriiknk
lggfyivgdiefgasehiakiilsaskfnpeiracmnikydgglikllkdkfavssfdrk
eeppnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviqkiy
ntle

Timeline for d2phpd_:

• d2phpd_ first appeared in SCOP 1.75, called d2phpd1
  
• d2phpd_ appears in SCOPe 2.04
  
• d2phpd_ is called d2phpd2 in SCOPe 2.06
  
• d2phpd_ appears in the current release, SCOPe 2.08, called d2phpd2