Lineage for d2pgxa1 (2pgx A:1-250)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130499Family c.66.1.55: YhiQ-like [159686] (1 protein)
    Pfam PF04445; DUF548; contains extra N-terminal alpha+beta subdomain [beta-alpha-beta(4)]
  6. 2130500Protein Hypothetical protein YhiQ [159687] (3 species)
  7. 2130501Species Escherichia coli [TaxId:562] [159688] (1 PDB entry)
    Uniprot P68568 1-250
  8. 2130502Domain d2pgxa1: 2pgx A:1-250 [149463]

Details for d2pgxa1

PDB Entry: 2pgx (more details), 2 Å

PDB Description: crystal structure of upf0341 protein yhiq from e. coli, northeast structural genomics target er585
PDB Compounds: (A:) UPF0341 protein yhiQ

SCOPe Domain Sequences for d2pgxa1:

Sequence, based on SEQRES records: (download)

>d2pgxa1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Escherichia coli [TaxId: 562]}
mkiclidetgtgdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv
ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp
vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqks
alvkkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkgh
rfdiyagtpv

Sequence, based on observed residues (ATOM records): (download)

>d2pgxa1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Escherichia coli [TaxId: 562]}
mkiclidetgtgdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv
ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp
vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqlv
kkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkghrfd
iyagtpv

SCOPe Domain Coordinates for d2pgxa1:

Click to download the PDB-style file with coordinates for d2pgxa1.
(The format of our PDB-style files is described here.)

Timeline for d2pgxa1: