Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) |
Family c.66.1.55: YhiQ-like [159686] (1 protein) Pfam PF04445; DUF548; contains extra N-terminal alpha+beta subdomain [beta-alpha-beta(4)] |
Protein Hypothetical protein YhiQ [159687] (3 species) |
Species Escherichia coli [TaxId:562] [159688] (1 PDB entry) Uniprot P68568 1-250 |
Domain d2pgxa1: 2pgx A:1-250 [149463] |
PDB Entry: 2pgx (more details), 2 Å
SCOP Domain Sequences for d2pgxa1:
Sequence, based on SEQRES records: (download)
>d2pgxa1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Escherichia coli [TaxId: 562]} mkiclidetgtgdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqks alvkkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkgh rfdiyagtpv
>d2pgxa1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Escherichia coli [TaxId: 562]} mkiclidetgtgdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqlv kkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkghrfd iyagtpv
Timeline for d2pgxa1: