Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.4: Link domain [56477] (3 proteins) |
Protein TSG-6, Link module [56478] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56479] (5 PDB entries) |
Domain d2pf5d_: 2pf5 D: [149450] automated match to d1o7bt_ complexed with 2pe, so4 |
PDB Entry: 2pf5 (more details), 1.9 Å
SCOPe Domain Sequences for d2pf5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pf5d_ d.169.1.4 (D:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]} gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp ivkpgpncgfgktgiidygirlnrserwdaycynph
Timeline for d2pf5d_:
View in 3D Domains from other chains: (mouse over for more information) d2pf5a_, d2pf5b_, d2pf5c_, d2pf5e_ |