Lineage for d2pf5d_ (2pf5 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002036Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 3002043Protein TSG-6, Link module [56478] (1 species)
  7. 3002044Species Human (Homo sapiens) [TaxId:9606] [56479] (5 PDB entries)
  8. 3002048Domain d2pf5d_: 2pf5 D: [149450]
    automated match to d1o7bt_
    complexed with 2pe, so4

Details for d2pf5d_

PDB Entry: 2pf5 (more details), 1.9 Å

PDB Description: Crystal Structure of the Human TSG-6 Link Module
PDB Compounds: (D:) tumor necrosis factor-inducible protein tsg-6

SCOPe Domain Sequences for d2pf5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf5d_ d.169.1.4 (D:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynph

SCOPe Domain Coordinates for d2pf5d_:

Click to download the PDB-style file with coordinates for d2pf5d_.
(The format of our PDB-style files is described here.)

Timeline for d2pf5d_: