SCOP 1.75: Domain d2pf5d1: 2pf5 D:1-95

Lineage for d2pf5d1 (2pf5 D:1-95)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.4: Link domain [56477] (2 proteins)

6. Protein TSG-6, Link module [56478] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56479] (3 PDB entries)

8. Domain d2pf5d1: 2pf5 D:1-95 [149450]
   automatically matched to d1o7bt_
   complexed with 2pe, so4

Details for d2pf5d1

PDB Entry: 2pf5, 1.9 Å

PDB Description: Crystal Structure of the Human TSG-6 Link Module

PDB Compounds: (D:) tumor necrosis factor-inducible protein tsg-6

SCOP Domain Sequences for d2pf5d1:

Sequence; same for both SEQRES and ATOM records:

>d2pf5d1 d.169.1.4 (D:1-95) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynp

Timeline for d2pf5d1:

• d2pf5d1 is new in SCOP 1.75
  
• d2pf5d1 is called d2pf5d_ in SCOPe 2.01
  
• d2pf5d1 appears in the current release, SCOPe 2.08, called d2pf5d_