SCOPe 2.08: Domain d2pe5a1: 2pe5 A:2-61

Lineage for d2pe5a1 (2pe5 A:2-61)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)

8. Domain d2pe5a1: 2pe5 A:2-61 [149392]
   Other proteins in same PDB: d2pe5a2, d2pe5b2, d2pe5c2
   automatically matched to d1cjga_
   protein/DNA complex; complexed with 145

Details for d2pe5a1

PDB Entry: 2pe5, 3.5 Å

PDB Description: crystal structure of the lac repressor bound to onpg in repressed state

PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2pe5a1:

Sequence; same for both SEQRES and ATOM records:

>d2pe5a1 a.35.1.5 (A:2-61) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql

Timeline for d2pe5a1:

• d2pe5a1 first appeared in SCOP 1.75
  
• d2pe5a1 appears in SCOPe 2.07