SCOPe 2.08: Domain d2p49b_: 2p49 B:

Lineage for d2p49b_ (2p49 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d2p49b_: 2p49 B: [149207]
   Other proteins in same PDB: d2p49a_
   automated match to d1bzqk_
   protein/RNA complex; complexed with po4

Details for d2p49b_

PDB Entry: 2p49, 1.38 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form

PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p49b_:

Sequence; same for both SEQRES and ATOM records:

>d2p49b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
gsqvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggt
lyadsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvt
vss

Timeline for d2p49b_:

• d2p49b_ first appeared in SCOP 1.75, called d2p49b1
  
• d2p49b_ appears in SCOPe 2.07