SCOP 1.75: Domain d2p49b1: 2p49 B:1-121

Lineage for d2p49b1 (2p49 B:1-121)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries)
   SQ NA # camelid antibody

8. Domain d2p49b1: 2p49 B:1-121 [149207]
   Other proteins in same PDB: d2p49a1
   automatically matched to d1bzqk_
   complexed with po4

Details for d2p49b1

PDB Entry: 2p49, 1.38 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form

PDB Compounds: (B:) antibody cab-rn05

SCOP Domain Sequences for d2p49b1:

Sequence; same for both SEQRES and ATOM records:

>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

Timeline for d2p49b1:

• d2p49b1 is new in SCOP 1.75
  
• d2p49b1 is called d2p49b_ in SCOPe 2.01
  
• d2p49b1 appears in the current release, SCOPe 2.08, called d2p49b_