Lineage for d2p3pa1 (2p3p A:66-262)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243551Fold d.383: PG1388-like [160924] (1 superfamily)
    consists of 2 alpha+beta subdomains, each having a meander beta-sheet; d1: alpha(2)-beta(7); d2: alpha(2)-beta(2)-alpha(2)-beta(2)
  4. 2243552Superfamily d.383.1: PG1388-like [160925] (1 family) (S)
    automatically mapped to Pfam PF11644
  5. 2243553Family d.383.1.1: PG1388-like [160926] (1 protein)
    PfamB PB104512
  6. 2243554Protein Hypothetical protein PG1388 [160927] (1 species)
  7. 2243555Species Porphyromonas gingivalis [TaxId:837] [160928] (1 PDB entry)
    Uniprot Q7MUU3 66-262
  8. 2243556Domain d2p3pa1: 2p3p A:66-262 [149183]
    complexed with mg

Details for d2p3pa1

PDB Entry: 2p3p (more details), 1.76 Å

PDB Description: Structure of a domain of an uncharacterized protein PG_1388 from Porphyromonas gingivalis W83
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2p3pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3pa1 d.383.1.1 (A:66-262) Hypothetical protein PG1388 {Porphyromonas gingivalis [TaxId: 837]}
agelercflampesvlpivtmeerndlcrraghlsgfthtaslesslggtvtfllnrnfi
riqtstvgevfmrilpfsdsssvicvvttvlhpvadsridfyttewkplktdrfwqqpri
edfflphtdrqsyayqaiyasltpsymqvslseesdtlsirqtvtetlaeeekplaaifl
speplvyrwqsgrfvrq

SCOPe Domain Coordinates for d2p3pa1:

Click to download the PDB-style file with coordinates for d2p3pa1.
(The format of our PDB-style files is described here.)

Timeline for d2p3pa1: