![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.2: DinB-like [140603] (4 proteins) Pfam PF05163 |
![]() | Protein Hypothetical protein BCE2162 [158513] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [158514] (1 PDB entry) Uniprot Q739H9 1-142 |
![]() | Domain d2p1ab2: 2p1a B:1-149 [149160] Other proteins in same PDB: d2p1aa2, d2p1ab3 automated match to d2p1aa1 |
PDB Entry: 2p1a (more details), 2.1 Å
SCOPe Domain Sequences for d2p1ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p1ab2 a.213.1.2 (B:1-149) Hypothetical protein BCE2162 {Bacillus cereus [TaxId: 1396]} mfvqsalhqlkvavdtsiqmldqyteidlkiapiqskrslfemyahlslichadllilng stekelhtfykeqtpetiaqmqktmiqgydllsktflsysneqlaemktaywgisysrfe wlleivahfyhhrgqihillcehmkdpni
Timeline for d2p1ab2: