SCOPe 2.08: Domain d2p1aa1: 2p1a A:1-142

Lineage for d2p1aa1 (2p1a A:1-142)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.2: DinB-like [140603] (4 proteins)
   Pfam PF05163

6. Protein Hypothetical protein BCE2162 [158513] (1 species)

7. Species Bacillus cereus [TaxId:1396] [158514] (1 PDB entry)
   Uniprot Q739H9 1-142

8. Domain d2p1aa1: 2p1a A:1-142 [149159]
   Other proteins in same PDB: d2p1aa2, d2p1ab3

Details for d2p1aa1

PDB Entry: 2p1a, 2.1 Å

PDB Description: crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2p1aa1:

Sequence; same for both SEQRES and ATOM records:

>d2p1aa1 a.213.1.2 (A:1-142) Hypothetical protein BCE2162 {Bacillus cereus [TaxId: 1396]}
mfvqsalhqlkvavdtsiqmldqyteidlkiapiqskrslfemyahlslichadllilng
stekelhtfykeqtpetiaqmqktmiqgydllsktflsysneqlaemktaywgisysrfe
wlleivahfyhhrgqihillce

Timeline for d2p1aa1:

• d2p1aa1 first appeared in SCOP 1.75
  
• d2p1aa1 appears in SCOPe 2.07