Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins) PfamB PB001946 |
Protein Nsp15, C-terminal domain [142882] (2 species) |
Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries) Uniprot Q6VA80 6620-6774 |
Domain d2ozkb2: 2ozk B:191-332 [149110] Other proteins in same PDB: d2ozka1, d2ozkb1, d2ozkc1, d2ozkd1 automated match to d2ozka2 |
PDB Entry: 2ozk (more details), 2.9 Å
SCOPe Domain Sequences for d2ozkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozkb2 d.294.1.2 (B:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]} etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsviskvvkvtidyaeisfmlw
Timeline for d2ozkb2: