SCOPe 2.07: Domain d2ozka2: 2ozk A:191-332

Lineage for d2ozka2 (2ozk A:191-332)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.294: EndoU-like [142876] (1 superfamily)
comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

Superfamily d.294.1: EndoU-like [142877] (3 families)

similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
PfamB PB001946
Protein Nsp15, C-terminal domain [142882] (2 species)
Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
Uniprot Q6VA80 6620-6774
Domain d2ozka2: 2ozk A:191-332 [149108]
Other proteins in same PDB: d2ozka1, d2ozkb1, d2ozkc1, d2ozkd1

Details for d2ozka2

PDB Entry: 2ozk (more details), 2.9 Å

PDB Description: structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus

PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d2ozka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozka2 d.294.1.2 (A:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsviskvvkvtidyaeisfmlw

SCOPe Domain Coordinates for d2ozka2:

Click to download the PDB-style file with coordinates for d2ozka2.
(The format of our PDB-style files is described here.)

Timeline for d2ozka2: