Lineage for d2ozga2 (2ozg A:8-290)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664787Family d.108.1.10: EF1021-like [160644] (3 proteins)
    duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site
  6. 1664796Protein Putative acetyltransferase Ava4977 [160647] (1 species)
  7. 1664797Species Anabaena variabilis [TaxId:1172] [160648] (1 PDB entry)
    Uniprot Q3M362 8-290
  8. 1664798Domain d2ozga2: 2ozg A:8-290 [149106]
    Other proteins in same PDB: d2ozga1
    complexed with act, coa, peg

Details for d2ozga2

PDB Entry: 2ozg (more details), 2 Å

PDB Description: crystal structure of gcn5-related n-acetyltransferase (yp_325469.1) from anabaena variabilis atcc 29413 at 2.00 a resolution
PDB Compounds: (A:) GCN5-related N-acetyltransferase

SCOPe Domain Sequences for d2ozga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}
rfkytkasqeniqqlgnileqcfvmsfgdseiyvkgiglenfrviyreqkvagglailpm
gqwwggqrvpmagiaavgiapeyrgdgaaialiqhtlqeiseqdipisvlypatqrlyrk
agyeqagsscvweiptdsiqiqhaslplepvvlknnpifhelyqqqaqlthgyldrhpai
wqglnrtldtetlysyligdkdkpqgyiiftqertrdgsilrirdwvtlsnpavqsfwtf
ianhrsqidkvtwkssvidaltlllpeqsatirsqdrwmlriv

SCOPe Domain Coordinates for d2ozga2:

Click to download the PDB-style file with coordinates for d2ozga2.
(The format of our PDB-style files is described here.)

Timeline for d2ozga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ozga1