SCOPe 2.03: Domain d2ozga2: 2ozg A:8-290

Lineage for d2ozga2 (2ozg A:8-290)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.10: EF1021-like [160644] (3 proteins)
   duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site

6. Protein Putative acetyltransferase Ava4977 [160647] (1 species)

7. Species Anabaena variabilis [TaxId:1172] [160648] (1 PDB entry)
   Uniprot Q3M362 8-290

8. Domain d2ozga2: 2ozg A:8-290 [149106]
   Other proteins in same PDB: d2ozga1
   complexed with act, coa, peg

Details for d2ozga2

PDB Entry: 2ozg, 2 Å

PDB Description: crystal structure of gcn5-related n-acetyltransferase (yp_325469.1) from anabaena variabilis atcc 29413 at 2.00 a resolution

PDB Compounds: (A:) GCN5-related N-acetyltransferase

SCOPe Domain Sequences for d2ozga2:

Sequence; same for both SEQRES and ATOM records:

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}
rfkytkasqeniqqlgnileqcfvmsfgdseiyvkgiglenfrviyreqkvagglailpm
gqwwggqrvpmagiaavgiapeyrgdgaaialiqhtlqeiseqdipisvlypatqrlyrk
agyeqagsscvweiptdsiqiqhaslplepvvlknnpifhelyqqqaqlthgyldrhpai
wqglnrtldtetlysyligdkdkpqgyiiftqertrdgsilrirdwvtlsnpavqsfwtf
ianhrsqidkvtwkssvidaltlllpeqsatirsqdrwmlriv

Timeline for d2ozga2:

• d2ozga2 first appeared in SCOP 1.75
  
• d2ozga2 appears in SCOPe 2.02
  
• d2ozga2 appears in SCOPe 2.04
  
• d2ozga2 appears in the current release, SCOPe 2.08