![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.10: EF1021-like [160644] (3 proteins) duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site |
![]() | Protein Putative acetyltransferase Ava4977 [160647] (1 species) |
![]() | Species Anabaena variabilis [TaxId:1172] [160648] (1 PDB entry) Uniprot Q3M362 8-290 |
![]() | Domain d2ozga2: 2ozg A:8-290 [149106] Other proteins in same PDB: d2ozga1 complexed with act, coa, peg |
PDB Entry: 2ozg (more details), 2 Å
SCOPe Domain Sequences for d2ozga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} rfkytkasqeniqqlgnileqcfvmsfgdseiyvkgiglenfrviyreqkvagglailpm gqwwggqrvpmagiaavgiapeyrgdgaaialiqhtlqeiseqdipisvlypatqrlyrk agyeqagsscvweiptdsiqiqhaslplepvvlknnpifhelyqqqaqlthgyldrhpai wqglnrtldtetlysyligdkdkpqgyiiftqertrdgsilrirdwvtlsnpavqsfwtf ianhrsqidkvtwkssvidaltlllpeqsatirsqdrwmlriv
Timeline for d2ozga2: