Lineage for d2ozga1 (2ozg A:291-395)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426777Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1426778Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1426811Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins)
  6. 1426820Protein Putative acetyltransferase Ava4977 [160625] (1 species)
  7. 1426821Species Anabaena variabilis [TaxId:1172] [160626] (1 PDB entry)
    Uniprot Q3M362 291-395
  8. 1426822Domain d2ozga1: 2ozg A:291-395 [149105]
    Other proteins in same PDB: d2ozga2
    complexed with act, coa, peg

Details for d2ozga1

PDB Entry: 2ozg (more details), 2 Å

PDB Description: crystal structure of gcn5-related n-acetyltransferase (yp_325469.1) from anabaena variabilis atcc 29413 at 2.00 a resolution
PDB Compounds: (A:) GCN5-related N-acetyltransferase

SCOPe Domain Sequences for d2ozga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozga1 d.106.1.4 (A:291-395) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}
nvckaleargyplgveaelhlevqddllatnqgkfilsvangksevtkggkgelqldikg
laslytslftprqlqltgklqatetallkatqifagespwmidff

SCOPe Domain Coordinates for d2ozga1:

Click to download the PDB-style file with coordinates for d2ozga1.
(The format of our PDB-style files is described here.)

Timeline for d2ozga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ozga2