SCOPe 2.01: Domain d2ox7c_: 2ox7 C:

Lineage for d2ox7c_ (2ox7 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.172: YopX-like [159005] (1 superfamily)
   consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold

4. Superfamily b.172.1: YopX-like [159006] (2 families)
   conmrises proteins of plasmid and phage origins

5. Family b.172.1.1: YopX-like [159007] (3 proteins)
   Pfam PF09643

6. Protein Hypothetical protein EF1440 [159008] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159009] (1 PDB entry)
   Uniprot Q835D7 1-143

8. Domain d2ox7c_: 2ox7 C: [149056]
   automated match to d2ox7a1

Details for d2ox7c_

PDB Entry: 2ox7, 1.78 Å

PDB Description: crystal structure of protein ef1440 from enterococcus faecalis

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2ox7c_:

Sequence; same for both SEQRES and ATOM records:

>d2ox7c_ b.172.1.1 (C:) Hypothetical protein EF1440 {Enterococcus faecalis [TaxId: 1351]}
slipkfrawdtyekemlenvtplfddsnsmiaiitdfqikgspgtseieigsydttfnwd
efpyvimqstglkdkngveifegdilvydapkkyahrrsmheiayadgrffwefldlvfc
qsnilyrdgylvignihenpell

Timeline for d2ox7c_:

• d2ox7c_ first appeared in SCOP 1.75, called d2ox7c1
  
• d2ox7c_ appears in SCOPe 2.02
  
• d2ox7c_ appears in the current release, SCOPe 2.08, called d2ox7c2