SCOP 1.75: Domain d2ox7c1: 2ox7 C:3-144

Lineage for d2ox7c1 (2ox7 C:3-144)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.172: YopX-like [159005] (1 superfamily)
   consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold

4. Superfamily b.172.1: YopX-like [159006] (1 family)
   conmrises proteins of plasmid and phage origins

5. Family b.172.1.1: YopX-like [159007] (3 proteins)
   Pfam PF09643

6. Protein Hypothetical protein EF1440 [159008] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159009] (1 PDB entry)
   Uniprot Q835D7 1-143

8. Domain d2ox7c1: 2ox7 C:3-144 [149056]
   automatically matched to 2OX7 A:3-145

Details for d2ox7c1

PDB Entry: 2ox7, 1.78 Å

PDB Description: crystal structure of protein ef1440 from enterococcus faecalis

PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d2ox7c1:

Sequence; same for both SEQRES and ATOM records:

>d2ox7c1 b.172.1.1 (C:3-144) Hypothetical protein EF1440 {Enterococcus faecalis [TaxId: 1351]}
lipkfrawdtyekemlenvtplfddsnsmiaiitdfqikgspgtseieigsydttfnwde
fpyvimqstglkdkngveifegdilvydapkkyahrrsmheiayadgrffwefldlvfcq
snilyrdgylvignihenpell

Timeline for d2ox7c1:

• d2ox7c1 is new in SCOP 1.75
  
• d2ox7c1 is called d2ox7c_ in SCOPe 2.01
  
• d2ox7c1 appears in the current release, SCOPe 2.08, called d2ox7c2