Lineage for d2ox7b1 (2ox7 B:3-145)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 814115Fold b.172: YopX-like [159005] (1 superfamily)
    consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold
  4. 814116Superfamily b.172.1: YopX-like [159006] (1 family) (S)
    conmrises proteins of plasmid and phage origins
  5. 814117Family b.172.1.1: YopX-like [159007] (3 proteins)
    Pfam PF09643
  6. 814118Protein Hypothetical protein EF1440 [159008] (1 species)
  7. 814119Species Enterococcus faecalis [TaxId:1351] [159009] (1 PDB entry)
    Uniprot Q835D7 1-143
  8. 814121Domain d2ox7b1: 2ox7 B:3-145 [149055]
    automatically matched to 2OX7 A:3-145

Details for d2ox7b1

PDB Entry: 2ox7 (more details), 1.78 Å

PDB Description: crystal structure of protein ef1440 from enterococcus faecalis
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2ox7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox7b1 b.172.1.1 (B:3-145) Hypothetical protein EF1440 {Enterococcus faecalis [TaxId: 1351]}
lipkfrawdtyekemlenvtplfddsnsmiaiitdfqikgspgtseieigsydttfnwde
fpyvimqstglkdkngveifegdilvydapkkyahrrsmheiayadgrffwefldlvfcq
snilyrdgylvignihenpelle

SCOP Domain Coordinates for d2ox7b1:

Click to download the PDB-style file with coordinates for d2ox7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ox7b1: