Lineage for d2ou3b_ (2ou3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344307Fold a.287: TerB-like [158681] (1 superfamily)
    multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry
  4. 2344308Superfamily a.287.1: TerB-like [158682] (2 families) (S)
    members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure
  5. 2344309Family a.287.1.1: COG3793-like [158683] (1 protein)
    Pfam PF07049; DUF1332
  6. 2344310Protein Tellurite resistance protein of COG3793 [158684] (1 species)
  7. 2344311Species Nostoc punctiforme pcc 73102 [TaxId:63737] [158685] (1 PDB entry)
  8. 2344313Domain d2ou3b_: 2ou3 B: [149019]
    automated match to d2ou3a1
    complexed with cl, edo, i3a, zn

Details for d2ou3b_

PDB Entry: 2ou3 (more details), 1.85 Å

PDB Description: crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution
PDB Compounds: (B:) Tellurite resistance protein of COG3793

SCOPe Domain Sequences for d2ou3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ou3b_ a.287.1.1 (B:) Tellurite resistance protein of COG3793 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
msdikklgsswiinwffgfnqiptnedssiymksvltcakadgvispeekdwalgfcasw
gvadwviedlktyeadealeeviarspqvsmaqrdillsaiwvsaadgelhekekakirk
matilgikeeivdqleqlyyyeaalrqkrlnllypqkspy

SCOPe Domain Coordinates for d2ou3b_:

Click to download the PDB-style file with coordinates for d2ou3b_.
(The format of our PDB-style files is described here.)

Timeline for d2ou3b_: