SCOP 1.75: Domain d2ou3b1: 2ou3 B:1-160

Lineage for d2ou3b1 (2ou3 B:1-160)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.287: TerB-like [158681] (1 superfamily)
   multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry

4. Superfamily a.287.1: TerB-like [158682] (2 families)
   members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure

5. Family a.287.1.1: COG3793-like [158683] (1 protein)
   Pfam PF07049; DUF1332

6. Protein Tellurite resistance protein of COG3793 [158684] (1 species)

7. Species Nostoc punctiforme pcc 73102 [TaxId:63737] [158685] (1 PDB entry)

8. Domain d2ou3b1: 2ou3 B:1-160 [149019]
   automatically matched to 2OU3 A:1-160
   complexed with cl, edo, i3a, zn; mutant

Details for d2ou3b1

PDB Entry: 2ou3, 1.85 Å

PDB Description: crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution

PDB Compounds: (B:) Tellurite resistance protein of COG3793

SCOP Domain Sequences for d2ou3b1:

Sequence; same for both SEQRES and ATOM records:

>d2ou3b1 a.287.1.1 (B:1-160) Tellurite resistance protein of COG3793 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
msdikklgsswiinwffgfnqiptnedssiymksvltcakadgvispeekdwalgfcasw
gvadwviedlktyeadealeeviarspqvsmaqrdillsaiwvsaadgelhekekakirk
matilgikeeivdqleqlyyyeaalrqkrlnllypqkspy

Timeline for d2ou3b1:

• d2ou3b1 is new in SCOP 1.75
  
• d2ou3b1 is called d2ou3b_ in SCOPe 2.01
  
• d2ou3b1 appears in the current release, SCOPe 2.08, called d2ou3b_