Lineage for d2ooxa1 (2oox A:449-576)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040830Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 1040839Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1040847Protein Snf1-like protein kinase ssp2 [160726] (1 species)
  7. 1040848Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries)
    Uniprot O74536 449-576
  8. 1040851Domain d2ooxa1: 2oox A:449-576 [148940]
    Other proteins in same PDB: d2ooxb1, d2ooxd_, d2ooxe1, d2ooxe2
    complexed with amp

Details for d2ooxa1

PDB Entry: 2oox (more details), 2.6 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP
PDB Compounds: (A:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d2ooxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ooxa1 d.129.6.2 (A:449-576) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
rnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckr
egkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcam
lvcklfsa

SCOPe Domain Coordinates for d2ooxa1:

Click to download the PDB-style file with coordinates for d2ooxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ooxa1: