![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.6: KA1-like [103243] (3 families) ![]() contains a single copy of this fold |
![]() | Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
![]() | Protein Snf1-like protein kinase ssp2 [160726] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries) Uniprot O74536 449-576 |
![]() | Domain d2ooxa1: 2oox A:449-576 [148940] Other proteins in same PDB: d2ooxb1, d2ooxd_, d2ooxe1, d2ooxe2, d2ooxe3, d2ooxg1, d2ooxg2, d2ooxg3 complexed with amp |
PDB Entry: 2oox (more details), 2.6 Å
SCOPe Domain Sequences for d2ooxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooxa1 d.129.6.2 (A:449-576) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} rnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckr egkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcam lvcklfsa
Timeline for d2ooxa1: