Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
Protein Hypothetical protein NE0621 [160287] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [160288] (1 PDB entry) Uniprot Q82WP3 1-98 |
Domain d2omod2: 2omo D:1-97 [148874] Other proteins in same PDB: d2omoa2, d2omob3, d2omoc3, d2omod3, d2omof3, d2omog3, d2omoh3 automated match to d2omoa1 |
PDB Entry: 2omo (more details), 1.83 Å
SCOPe Domain Sequences for d2omod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omod2 d.58.4.11 (D:1-97) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]} myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrk daaahketahyltwrdtvadwmaeprkgviygglypt
Timeline for d2omod2: