SCOPe 2.07: Domain d2omoc2: 2omo C:1-98

Lineage for d2omoc2 (2omo C:1-98)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (5 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein NE0621 [160287] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [160288] (1 PDB entry)
   Uniprot Q82WP3 1-98

8. Domain d2omoc2: 2omo C:1-98 [148873]
   Other proteins in same PDB: d2omoa2, d2omob3, d2omoc3, d2omod3, d2omof3, d2omog3, d2omoh3
   automated match to d2omoa1

Details for d2omoc2

PDB Entry: 2omo, 1.83 Å

PDB Description: putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea

PDB Compounds: (C:) duf176

SCOPe Domain Sequences for d2omoc2:

Sequence; same for both SEQRES and ATOM records:

>d2omoc2 d.58.4.11 (C:1-98) Hypothetical protein NE0621 {Nitrosomonas europaea [TaxId: 915]}
myvtivyasvktdkteafkeatrmnheqsirepgnmrfdilqsaddptrfvlyeayktrk
daaahketahyltwrdtvadwmaeprkgviygglyptg

Timeline for d2omoc2:

• d2omoc2 first appeared in SCOP 1.75, called d2omoc1
  
• d2omoc2 appears in SCOPe 2.06
  
• d2omoc2 appears in the current release, SCOPe 2.08