Lineage for d2om2c2 (2om2 C:1030-1060,C:1182-1347)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988473Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 988495Species Human (Homo sapiens) [TaxId:9606] [159560] (3 PDB entries)
  8. 988497Domain d2om2c2: 2om2 C:1030-1060,C:1182-1347 [148864]
    Other proteins in same PDB: d2om2a1, d2om2c1
    automatically matched to d1kjya2
    complexed with gdp, mg

Details for d2om2c2

PDB Entry: 2om2 (more details), 2.2 Å

PDB Description: Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14
PDB Compounds: (C:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2om2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2om2c2 c.37.1.8 (C:1030-1060,C:1182-1347) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
garevkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserk
kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
knvqfvfdavtdviiknn

SCOPe Domain Coordinates for d2om2c2:

Click to download the PDB-style file with coordinates for d2om2c2.
(The format of our PDB-style files is described here.)

Timeline for d2om2c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2om2c1