SCOPe 2.08: Domain d2om2a1: 2om2 A:61-181

Lineage for d2om2a1 (2om2 A:61-181)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)

8. Domain d2om2a1: 2om2 A:61-181 [148861]
   Other proteins in same PDB: d2om2a2, d2om2a3, d2om2c2, d2om2c3
   automatically matched to d1kjya1
   complexed with gdp, mg

Details for d2om2a1

PDB Entry: 2om2, 2.2 Å

PDB Description: Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2om2a1:

Sequence; same for both SEQRES and ATOM records:

>d2om2a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d2om2a1:

• d2om2a1 first appeared in SCOP 1.75
  
• d2om2a1 appears in SCOPe 2.07