| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries) |
| Domain d2om2a1: 2om2 A:61-181 [148861] Other proteins in same PDB: d2om2a2, d2om2a3, d2om2c2, d2om2c3 automatically matched to d1kjya1 complexed with gdp, mg |
PDB Entry: 2om2 (more details), 2.2 Å
SCOPe Domain Sequences for d2om2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2om2a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
Timeline for d2om2a1: