PDB entry 2om2

View 2om2 on RCSB PDB site
Description: Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14
Class: signaling protein
Keywords: Arginine finger, RGS14 GoLoco, SIGNALING PROTEIN
Deposited on 2007-01-20, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63096
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2om2a1, d2om2a2, d2om2a3
  • Chain 'B':
    Compound: Regulator of G-protein signalling 14 GoLoco motif peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63096 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2om2c1, d2om2c2, d2om2c3
  • Chain 'D':
    Compound: Regulator of G-protein signalling 14 GoLoco motif peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2om2A (A:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om2A (A:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2om2C (C:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om2C (C:)
    garevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramg
    rlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqln
    dsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserk
    kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
    kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
    knvqfvfdavtdviiknn
    

  • Chain 'D':
    No sequence available.