Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Penicillin-binding protein 2, PBP2 [160970] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [160971] (3 PDB entries) Uniprot Q2YY56 293-692 |
Domain d2olvb2: 2olv B:293-692 [148824] Other proteins in same PDB: d2olva1, d2olvb1 automated match to d2olva2 complexed with m0e |
PDB Entry: 2olv (more details), 2.8 Å
SCOPe Domain Sequences for d2olvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2olvb2 e.3.1.1 (B:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} tnqdseynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsf yknkdqqvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaien mkwatnhaiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagn dapkkfaaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvt rdgetieydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygae tysqynlpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvm skissrdgedfkrpssvsgsipsinvsgsqdnnttnrsth
Timeline for d2olvb2: