SCOPe 2.06: Domain d2oiwd_: 2oiw D:

Lineage for d2oiwd_ (2oiw D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein GK1870 orthologue [160182] (1 species)
   Predicted 4-hydroxybenzoyl-CoA thioesterase

7. Species Bacillus stearothermophilus [TaxId:1422] [160183] (1 PDB entry)
   Uniprot Q5KYT1 1-131

8. Domain d2oiwd_: 2oiw D: [148797]
   automated match to d2oiwa1
   complexed with edo, mg

Details for d2oiwd_

PDB Entry: 2oiw, 2 Å

PDB Description: The structure of a predicted thioesterase from Bacillus stearothermophilus

PDB Compounds: (D:) putative 4-hydroxybenzoyl-CoA thioesterase

SCOPe Domain Sequences for d2oiwd_:

Sequence; same for both SEQRES and ATOM records:

>d2oiwd_ d.38.1.1 (D:) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}
amfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevdy
vnqmyygqdvtvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipdd
irvklrehvw

Timeline for d2oiwd_:

• d2oiwd_ first appeared in SCOP 1.75, called d2oiwd1
  
• d2oiwd_ appears in SCOPe 2.05
  
• d2oiwd_ appears in SCOPe 2.07
  
• d2oiwd_ appears in the current release, SCOPe 2.08