Lineage for d2oiwa1 (2oiw A:1-131)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187730Protein GK1870 orthologue [160182] (1 species)
    Predicted 4-hydroxybenzoyl-CoA thioesterase
  7. 2187731Species Bacillus stearothermophilus [TaxId:1422] [160183] (1 PDB entry)
    Uniprot Q5KYT1 1-131
  8. 2187732Domain d2oiwa1: 2oiw A:1-131 [148794]
    complexed with edo, mg

Details for d2oiwa1

PDB Entry: 2oiw (more details), 2 Å

PDB Description: The structure of a predicted thioesterase from Bacillus stearothermophilus
PDB Compounds: (A:) putative 4-hydroxybenzoyl-CoA thioesterase

SCOPe Domain Sequences for d2oiwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}
mfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevdyv
nqmyygqdvtvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipddi
rvklrehvwqp

SCOPe Domain Coordinates for d2oiwa1:

Click to download the PDB-style file with coordinates for d2oiwa1.
(The format of our PDB-style files is described here.)

Timeline for d2oiwa1: