Lineage for d2oikb_ (2oik B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929776Protein Histidine triad protein Mfla2506 [159880] (1 species)
  7. 2929777Species Methylobacillus flagellatus [TaxId:405] [159881] (1 PDB entry)
    Uniprot Q1GYB6 6-144
  8. 2929779Domain d2oikb_: 2oik B: [148781]
    automated match to d2oika1
    complexed with cl, gol, zn

Details for d2oikb_

PDB Entry: 2oik (more details), 1.65 Å

PDB Description: crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution
PDB Compounds: (B:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d2oikb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oikb_ d.13.1.1 (B:) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]}
sfhkncelcttaggeilwqdalcrvvhvenqdypgfcrvilnrhvkemsdlrpaerdhlm
lvvfaveeavrevmrpdkinlaslgnmtphvhwhviprfkrdrhfpnsvwgetkreslpq
aldqgsttalkkaisvrld

SCOPe Domain Coordinates for d2oikb_:

Click to download the PDB-style file with coordinates for d2oikb_.
(The format of our PDB-style files is described here.)

Timeline for d2oikb_: