SCOP 1.75: Domain d2oikb1: 2oik B:6-144

Lineage for d2oikb1 (2oik B:6-144)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (4 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (7 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Histidine triad protein Mfla2506 [159880] (1 species)

7. Species Methylobacillus flagellatus [TaxId:405] [159881] (1 PDB entry)
   Uniprot Q1GYB6 6-144

8. Domain d2oikb1: 2oik B:6-144 [148781]
   automatically matched to 2OIK A:6-144
   complexed with cl, gol, zn

Details for d2oikb1

PDB Entry: 2oik, 1.65 Å

PDB Description: crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution

PDB Compounds: (B:) Histidine triad (HIT) protein

SCOP Domain Sequences for d2oikb1:

Sequence; same for both SEQRES and ATOM records:

>d2oikb1 d.13.1.1 (B:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]}
sfhkncelcttaggeilwqdalcrvvhvenqdypgfcrvilnrhvkemsdlrpaerdhlm
lvvfaveeavrevmrpdkinlaslgnmtphvhwhviprfkrdrhfpnsvwgetkreslpq
aldqgsttalkkaisvrld

Timeline for d2oikb1:

• d2oikb1 is new in SCOP 1.75
  
• d2oikb1 is called d2oikb_ in SCOPe 2.01
  
• d2oikb1 appears in the current release, SCOPe 2.08, called d2oikb_