| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
| Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
| Protein Histidine triad protein Mfla2506 [159880] (1 species) |
| Species Methylobacillus flagellatus [TaxId:405] [159881] (1 PDB entry) Uniprot Q1GYB6 6-144 |
| Domain d2oikc_: 2oik C: [148782] automated match to d2oika1 complexed with cl, gol, zn |
PDB Entry: 2oik (more details), 1.65 Å
SCOPe Domain Sequences for d2oikc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oikc_ d.13.1.1 (C:) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]}
msfhkncelcttaggeilwqdalcrvvhvenqdypgfcrvilnrhvkemsdlrpaerdhl
mlvvfaveeavrevmrpdkinlaslgnmtphvhwhviprfkrdrhfpnsvwgetkreslp
qaldqgsttalkkaisvrldq
Timeline for d2oikc_: