SCOPe 2.01: Domain d2od0b_: 2od0 B:

Lineage for d2od0b_ (2od0 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families)
   overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet

5. Family d.198.5.2: TfoX N-terminal domain-like [159898] (1 protein)
   Pfam PF04993

6. Protein Hypothetical protein VP1028 [159899] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [159900] (1 PDB entry)
   Uniprot Q87QX1 3-105

8. Domain d2od0b_: 2od0 B: [148733]
   automated match to d2od0a1
   complexed with mg, so4

Details for d2od0b_

PDB Entry: 2od0, 1.95 Å

PDB Description: The crystal structure of gene product VP1028 from Vibrio parahaemolyticus

PDB Compounds: (B:) Hypothetical protein VP1028

SCOPe Domain Sequences for d2od0b_:

Sequence; same for both SEQRES and ATOM records:

>d2od0b_ d.198.5.2 (B:) Hypothetical protein VP1028 {Vibrio parahaemolyticus [TaxId: 670]}
kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl
kpyvykkrgfpvvtkyyaisselwessdrlievakkslenak

Timeline for d2od0b_:

• d2od0b_ first appeared in SCOP 1.75, called d2od0b1
  
• d2od0b_ appears in SCOPe 2.02
  
• d2od0b_ appears in the current release, SCOPe 2.08