![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families) ![]() overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet |
![]() | Family d.198.5.2: TfoX N-terminal domain-like [159898] (1 protein) Pfam PF04993 |
![]() | Protein Hypothetical protein VP1028 [159899] (1 species) |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [159900] (1 PDB entry) Uniprot Q87QX1 3-105 |
![]() | Domain d2od0b_: 2od0 B: [148733] automated match to d2od0a1 complexed with mg, so4 |
PDB Entry: 2od0 (more details), 1.95 Å
SCOPe Domain Sequences for d2od0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od0b_ d.198.5.2 (B:) Hypothetical protein VP1028 {Vibrio parahaemolyticus [TaxId: 670]} kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl kpyvykkrgfpvvtkyyaisselwessdrlievakkslenak
Timeline for d2od0b_: