Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.25: BT0820-like [159540] (1 protein) PfamB PB073209; deletion in the common fold; segment-swapped dimer |
Protein Hypothetical protein BT0820 [159541] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [159542] (1 PDB entry) Uniprot Q8A9J5 1-122 |
Domain d2obba1: 2obb A:1-122 [148715] Other proteins in same PDB: d2obba2 complexed with mg |
PDB Entry: 2obb (more details), 2.2 Å
SCOPe Domain Sequences for d2obba1:
Sequence, based on SEQRES records: (download)
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra rglefyaankdypeeerdhqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiy sq
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra rglefyaankdypeehqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiysq
Timeline for d2obba1: