SCOPe 2.08: Domain d2obba1: 2obb A:1-122

Lineage for d2obba1 (2obb A:1-122)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.25: BT0820-like [159540] (1 protein)
   PfamB PB073209; deletion in the common fold; segment-swapped dimer

6. Protein Hypothetical protein BT0820 [159541] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [159542] (1 PDB entry)
   Uniprot Q8A9J5 1-122

8. Domain d2obba1: 2obb A:1-122 [148715]
   Other proteins in same PDB: d2obba2
   complexed with mg

Details for d2obba1

PDB Entry: 2obb, 2.2 Å

PDB Description: Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2obba1:

Sequence, based on SEQRES records:

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra
rglefyaankdypeeerdhqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiy
sq

Sequence, based on observed residues (ATOM records):

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra
rglefyaankdypeehqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiysq

Timeline for d2obba1:

• d2obba1 first appeared in SCOP 1.75
  
• d2obba1 appears in SCOPe 2.07