Lineage for d2obba1 (2obb A:1-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920266Family c.108.1.25: BT0820-like [159540] (1 protein)
    PfamB PB073209; deletion in the common fold; segment-swapped dimer
  6. 2920267Protein Hypothetical protein BT0820 [159541] (1 species)
  7. 2920268Species Bacteroides thetaiotaomicron [TaxId:818] [159542] (1 PDB entry)
    Uniprot Q8A9J5 1-122
  8. 2920269Domain d2obba1: 2obb A:1-122 [148715]
    Other proteins in same PDB: d2obba2
    complexed with mg

Details for d2obba1

PDB Entry: 2obb (more details), 2.2 Å

PDB Description: Structure of the conserved protein coded by locus BT_0820 from Bacteroides thetaiotaomicron
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2obba1:

Sequence, based on SEQRES records: (download)

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra
rglefyaankdypeeerdhqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiy
sq

Sequence, based on observed residues (ATOM records): (download)

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtiavdfdgtivehryprigeeipfavetlkllqqekhrlilwsvregelldeaiewcra
rglefyaankdypeehqgfsrklkadlfiddrnvggipdwgiiyemikekktfadiysq

SCOPe Domain Coordinates for d2obba1:

Click to download the PDB-style file with coordinates for d2obba1.
(The format of our PDB-style files is described here.)

Timeline for d2obba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2obba2