Lineage for d2o8pa1 (2o8p A:8-227)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007218Protein 14-3-3 domain containing protein cgd7_2470 [158768] (1 species)
  7. 2007219Species Cryptosporidium parvum [TaxId:5807] [158769] (1 PDB entry)
    Uniprot Q5CYG0 8-227
  8. 2007220Domain d2o8pa1: 2o8p A:8-227 [148679]

Details for d2o8pa1

PDB Entry: 2o8p (more details), 1.82 Å

PDB Description: crystal structure of a putative 14-3-3 protein from cryptosporidium parvum, cgd7_2470
PDB Compounds: (A:) 14-3-3 domain containing protein

SCOPe Domain Sequences for d2o8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]}
mderllqkyraqvfewggcfdkmfealksliylsefensefddeerhlltlcikhkisdy
rtmtsqvlqeqtkqlnndelvkicseyvfslrkdikaflqsfedcvdrlveksffskffk
lkvksdisryklefglcsledskkihqdaftllcehpdkieqlplgfiqnlayilsekyg
ekkqvfnmlnslgkilelqikeqenmdrkaqitvylqgik

SCOPe Domain Coordinates for d2o8pa1:

Click to download the PDB-style file with coordinates for d2o8pa1.
(The format of our PDB-style files is described here.)

Timeline for d2o8pa1: