Lineage for d2o8ga_ (2o8g A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938325Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1938351Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1938379Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (5 PDB entries)
  8. 1938385Domain d2o8ga_: 2o8g A: [148674]
    automated match to d3c5wc_
    complexed with mn

Details for d2o8ga_

PDB Entry: 2o8g (more details), 2.5 Å

PDB Description: rat pp1c gamma complexed with mouse inhibitor-2
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d2o8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o8ga_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae

SCOPe Domain Coordinates for d2o8ga_:

Click to download the PDB-style file with coordinates for d2o8ga_.
(The format of our PDB-style files is described here.)

Timeline for d2o8ga_: